GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA (2025)

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	57794
Gene name Gene Name - the full gene name approved by the HGNC.	SURP and G-patch domain containing 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SUGP1
Synonyms Gene synonyms aliases	F23858, RBP, SF4
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.11
Summary Summary of gene provided in NCBI Entrez Gene.	SF4 is a member of the SURP family of splicing factors.[supplied by OMIM, Sep 2003]

miRNA miRNA information provided by mirtarbase database.

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases

Show/Hide all(43)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023869	hsa-miR-1-3p	Proteomics;Microarray	18668037
MIRT049813	hsa-miR-92a-3p	CLASH	23622248
MIRT696426	hsa-miR-6728-5p	HITS-CLIP	23313552
MIRT696427	hsa-miR-6878-3p	HITS-CLIP	23313552
MIRT696428	hsa-miR-5187-5p	HITS-CLIP	23313552

Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases

Show/Hide all(6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000398	Process	MRNA splicing, via spliceosome	TAS
GO:0003723	Function	RNA binding	HDA	22681889
GO:0005515	Function	Protein binding	IPI	21988832, 22365833
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS

Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases

MIM	HGNC	e!Ensembl
607992	18643	ENSG00000105705

Protein

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases

UniProt ID

Q8IWZ8

Protein name

SURP and G-patch domain-containing protein 1 (RNA-binding protein RBP) (Splicing factor 4)

Protein function

Plays a role in pre-mRNA splicing.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01805	Surp	189 → 241	Surp module	Family
PF01805	Surp	264 → 316	Surp module	Family
PF01585	G-patch	562 → 607	G-patch domain	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in adult testis and heart, and in adult and fetal brain, kidney and skeletal muscle. {ECO:0000269|PubMed:12594045}.

Sequence

MSLKMDNRDVAGKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKMEQKAKQNQVA
SPQPPHPGEITNAHNSSCISNKFANDGSFLQQFLKLQKAQTSTDAPTSAPSAPPSTPTPS
AGKRSLLISRRTGLGLASLPGPVKSYSHAKQLPVAHRPSVFQSPDEDEEEDYEQWLEIKV
SPPEGAETRKVIEKLARFVAEGGPELEKVAMEDYKDNPAFAFLHDKNSREFLYYRKKVAEIRKEAQKSQAASQKVSPPEDEEVKNLAEKLARFIADGGPEVETIALQNNRENQAFSFLYEPNSQGYKYYRQKLEEFRKAKASSTGSFTAPDPGLKRKSPPEALSGSLPPATTCPASSTPA
PTIIPAPAAPGKPASAATVKRKRKSRWGPEEDKVELPPAELVQRDVDASPSPLSVQDLKG
LGYEKGKPVGLVGVTELSDAQKKQLKEQQEMQQMYDMIMQHKRAMQDMQLLWEKAVQQHQ
HGYDSDEEVDSELGTWEHQLRRMEMDKTREWAEQLTKMGRGKHFIGDFLPPDELEKFMET
FKALKEGREPDYSEYKEFKLTVENIGYQMLMKMGWKEGEGLGSEGQGIKNPVNKGTTTVDGAGFGIDRPAELSKEDDEYEAFRKRMMLAYRFRPNPLNNPRRPYY

Sequence length

645

Interactions

View interactions

Pathways Pathway information has different metabolic/signaling pathways associated with genes.

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases

	Reactome
			mRNA Splicing - Major Pathway

Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Diabetes mellitus	Diabetes Mellitus, Diabetes Mellitus, Non-Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613 View all (223 more)	27790247, 30054458, 22885922, 22885922, 30054458
Atrial fibrillation	Atrial Fibrillation	rs120074192, rs121908590, rs121908593, rs121434558, rs587776851, rs387906612, rs387906613, rs387906614, rs387906615, rs199472687, rs199472705, rs199473324, rs587777336, rs587777339, rs587777557 View all (6 more)	27790247
Obesity	Obesity	rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562 View all (20 more)	25246029

Show/Hide Unknown Diseases (5)

Disease term	Disease name	References	Source
Unknown
Coronary heart disease	Coronary heart disease	27790247, 21347282, 21347282, 27790247	ClinVar
Heart failure	Heart failure	27790247	ClinVar
Diabetes	Diabetes	27790247	ClinVar, GWAS
Non-alcoholic Fatty Liver Disease	Non-alcoholic Fatty Liver Disease		GWAS

GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA (2025)

References

https://gedipnet.bicnirrh.res.in/Gdb_testing/html/new_GgeneT.php?gens=SUGP1&GI=57794